Question

What do you notice about the divergence of the amino acid (protein) sequences when compared to...

  1. What do you notice about the divergence of the amino acid (protein) sequences when compared to the nucleotide (DNA) sequences?
  2. Given a large section of a gene, say a complete exon, how could you determine reading frame?
0 0
Add a comment Improve this question Transcribed image text
Answer #1

a. Amino acid sequences divergence would be more conserved than Nucleotide sequence divergence

example:

Nucleotide sequence: ATG AGG AGC AGT Mutated Nucleotide sequence: ATG CGG AGC AGT

Aminoacid sequence : Met Arg Ser Ser Mutated Aminoacid sequence : Met Arg Ser Ser

The examples shows a silent mutation which the aminoacid sequence cannot capture while the nucleotide sequence can capture. Divergence in the Nucleotide cannot be observed in Amino acid sequence due to degeneracy of codons (except for tryptophan and methionine all other 18 aminoacids more than one codon).

b. Exon is the part of mature-RNA after splicing and removing of introns from pre-mRNA from the transcription of a gene.

Reading Frame starts with a start codon (ATG) and ends with a stop codon (TGA,TAG,TAA). If exon does not contain start codon, stop codon or both of them , the exonic sequence can be aligned with the DNA sequence and the start codon before the exon to stop codon after the exon would be Reading Frame  

Add a comment
Know the answer?
Add Answer to:
What do you notice about the divergence of the amino acid (protein) sequences when compared to...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • In bacteria and eukaryotes, a mutation is when ________. the amino acid sequence in a protein...

    In bacteria and eukaryotes, a mutation is when ________. the amino acid sequence in a protein molecule is directly changed the nucleotide sequence in an mRNA molecule is directly changed the nucleotide sequence in a DNA molecule is directly changed the expression of a gene changes without the DNA sequence being changed

  • While comparing the amino acid sequences of many different GPCRs, you notice the presence of conserved...

    While comparing the amino acid sequences of many different GPCRs, you notice the presence of conserved serine and threonine amino acids on the same cytosolic region of each receptor. You change the DNA sequence so that all of the conserved serine and threonine amino acids in the cytosolic region are converted to glutamic acid. Which of the following effects would you most likely see when cells expressing this modified GPCR are exposed to ligand compared to your control cells that...

  • Dystrophin is a protein that forms part of a vital protein complex that connects the cytoskeleton...

    Dystrophin is a protein that forms part of a vital protein complex that connects the cytoskeleton of a muscle fiber cell to the extracellular matrix. This connection strengthens and shapes the muscle fibers. Dystrophin is coded by the DMD gene. This is one of the longest human genes known, covering 2,300,000 base pairs (0.08% of the human genome) It is located in chromosome 21. The immature mRNA is 2,100,000 bases long and takes 16 hours to transcribe. It contains 79...

  • Did I answer the mRNA sequences and Amino acid sequences correctly? What types of mutations are...

    Did I answer the mRNA sequences and Amino acid sequences correctly? What types of mutations are these? How do you do the bottom?   Part 3. Cystic Fibrosis Directions: Cystic Fibrosis is a disorder where the individuals have long and kidney problems. The disorder is caused by a mutation in one of the individual's genes. Complete the boxes below by finding the mRNA and amino acid sequence Compare the moutant DNA strands to the original strand. Circle the mutation in the...

  • Assume that the The DNA changes provided above represent the sequences in the TEMPLATE STRAND. Determine...

    Assume that the The DNA changes provided above represent the sequences in the TEMPLATE STRAND. Determine what effect would mutation 3 have on the protein. For location of mutation- either "Present in mature RNA"or "Absent in mature RNA" For Amino Acids- three letters in upper case, if no amino acids are formed, write "NA", if stop codon is coded write "STOP" For type of change-write "missense", "nonsense", "silent", "neutral" or "NA" Location of mutation Amino acid for Amino acid Type...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • How many different mRNA sequences can code for a polypeptide chain with the amino acid sequence...

    How many different mRNA sequences can code for a polypeptide chain with the amino acid sequence Met - Leu - Arg? Be sure to include a stop codon. Explain your answer! 5′ ...GGAGCUCGUUGUAUU... 3′ Is this sequence RNA or DNA? How can you tell? Which amino acids are encoded, if the reading frame is as shown, starting from the correct end? What would be the effect on the amino acid sequence if the sequence were changed to 5′ GGAGACUCGUUGUAUU 3′?...

  • 11. What is the first amino ackd of any initial protein that is A. Valine C....

    11. What is the first amino ackd of any initial protein that is A. Valine C. Lysine D. Tryptophan E. Methionine 12. Choose all that apply. Polymerase Chain Reaction (PCR) can be used to A Create a DNA profile of suspects, victims, and criminals during crime scene investigations B. Duplicate pieces C. Help determine paternity D. Stimulate cell division E. Stimulate gene expression of DNA into many copies using a special form of DNA polymerase 13. What occurs during transcription?...

  • QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is...

    QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...

  • 2.16. Which of the following partial amino acid sequences from a protein whose gene you wish...

    2.16. Which of the following partial amino acid sequences from a protein whose gene you wish to clone would be most useful in designing an oligonucleotide probe to screen a cDNA library? (a) Met-Leu-Arg-Leu (b) Met-Trp-Cys-Trp Explain why.

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT