Question

A1. The following is the DNA sequence of a hypothetical gene for the SMALL protein. It is called the SMALL gene. i atgggattac

Power supply sample wells Electrode A direction of movement Electrode B buffer solution Electrophoresis tank The DNA will be

0 0
Add a comment Improve this question Transcribed image text
Answer #1

A.Gel electrophoresis is a technique used to separate the DNA on their size and charge.Electrod A is negatively charged and Electrod B is positively charged.DNA fragments are negatively charged ,so they move towards to positively charged electrode(b),Because all the DNA fragments have the same amount of charge per mass ,small fragments move faster than the large ones.

B.Reverse primer:(with termination codon)

5'CTATAACTCGATTGATC3' GC=35% Tm-39.8C no self complementary ,no primer dimer

C.Polemrase Chain reaction(PCR) is a routine laboratory experiment which is used to amplify the particular DNA in test tube by using thernostable taqDNApolymerase,dNTPs,MgCl2,Primers,Buffers,DMSO and template.The PCR generally runs in various steps such as Denaturation,Elongation,Extenstion and these are occurs at high temperatures.So Taq DNA polymerase is thermostable enzyme from thermus aquaticus and its withstand at high temperatures   

D.The gene encodes 20 aminoacids they are MGLHCHDQIAFIVSKGSIEL .Because they are 60 basepairs and one stop codon so one aminoa acid is encoded by the three basepairs.

Add a comment
Know the answer?
Add Answer to:
A1. The following is the DNA sequence of a hypothetical gene for the SMALL protein. It...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • These are previous exam questions I am just preparing for the final exam by studying the...

    These are previous exam questions I am just preparing for the final exam by studying the previous questions! please help me out! A1. The following is the DNA sequence of a hypothetical gene for the SMALL protein. It is called the SMALL gene. 1 atgggattac actgtcacga ccaaatagcc ttcattgtat 41 caaaaggatc aatcgagtta tag Imagine you are doing a research project in a laboratory and your supervisor asks you to clone the SMALL gene into the pBR322 plasmid (shown below) You must...

  • Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI DNA sequence B: ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC CGCCAGGCGGAACGCATGAGCCAGATT

    Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI DNA sequence B: ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC CGCCAGGCGGAACGCATGAGCCAGATTAAACGCCTGCTG AGCGAAAAAAAAACCAGCCAGAGCCCGCATCGCTTTCAG AAAACCCATAGCCCGATT Primer Sequence C: 5’ CTGCTGCTGTTTATTGGC 3’ The first 20 amino acids in ‘Protein sequence A’ form a transmembrane helix. The remainder of the protein forms a globular cytoplasmic domain. (i) Without copying out any sequence, describe the product you would expect to generate from a PCR reaction using ‘Primer sequence C’ as the forward primer, ‘DNA sequence B’ as the template and a reverse primer that matches...

  • One strand of a DNA sequences is given below. Find the EcoRI sites and indicate the...

    One strand of a DNA sequences is given below. Find the EcoRI sites and indicate the cutting site with an arrow. Count the number of bases in each fragment. CP22: vne strand of a DNA sequence is given below. Find the EcoRI sites and indicate the cutting site with an arrow. Count the number of bases in each fragment. Restriction digest A: ATTGAATTCCGGTTAGCTTTAGAATTCCGCCATATGCGCAATTGGAATTCC Number of bases in each fragment: Now compare the same region of DNA from another individual. Where...

  • 25. Promoter 26. Replication 27. RNA Polymerase F. Sequence of DNA that controls gene express G....

    25. Promoter 26. Replication 27. RNA Polymerase F. Sequence of DNA that controls gene express G. binds an operator and stops gene expression in LAC operon by preventing RNA polymerase from binding gene and transcribing. H. Duplication of DNA in S phase of Interphase 28. Codon 29. Transgenic 30. Recombinant DNA 31. PCR 32. 33. 34. 35. 36. 37. 38. Plasmid Gene Therapy Gel electrophoresis DNA Profile DNA ligase GMO concern GMO benefit A. Analyzing STR patterns of blood or...

  • 8. DNA cloning. The first DNA clone using recombinant DNA technology was human insulin, which was...

    8. DNA cloning. The first DNA clone using recombinant DNA technology was human insulin, which was made in 1978. The insulin gene was inserted into a plasmid and the gene was transcribed and translated from the plasmid in E coll cells. Insulin is synthesized by ribosomes in human pancreatic cells. Insulin is synthesized as a longer polypeptide, which is then trimmed by proteases to make the mature chains A and B (see Fig. 2.17 on page 39 of your textbook)....

  • 12. To see if your polymerase chain reaction was successful and it amplified the right sequence...

    12. To see if your polymerase chain reaction was successful and it amplified the right sequence of interest, you electrophorese the products from the reaction on an agarose gel. After staining the gel you find there are two bands of different sizes. Which one of the following is a possible explanation for these results? (1 point) a. The PCR induced a frame shift mutation into the DNA sequence. b. RNA polymerase copied the DNA into two copies of RNA. c....

  • Chromosomal and plasmid DNA can be cut into manageable pieces by restriction enzymes. Using agarose gel...

    Chromosomal and plasmid DNA can be cut into manageable pieces by restriction enzymes. Using agarose gel electrophoresis, the DNA fragments can be separated on a gel, based on their lengths. In order to see the fragments, a stain is typically added to the gel. The size of each fragment can be determined by comparing each one to a DNA molecular weight marker of known size. Below is a map of pBR22 plasmid. The position and base pair number of the...

  • III. Subclone the gene into plasmid, extract the plasmid DNA. 5. You know that your insert...

    III. Subclone the gene into plasmid, extract the plasmid DNA. 5. You know that your insert (gene of interest, GOI) is flanked by the EcoRI sites, which makes this restriction enzyme a perfect candidate to cut out your gene. You also know that the GOI has a unique BamH1 restriction site. After subcloning the PCR product into the plasmid, a purified DNA preparation of the plasmid is digested to completion with BamHI restriction endonuclease. In separate reactions, the same preparation...

  • 27. RNA Polymerase ence of DNA that controls gene expression G. binds an operator and stops...

    27. RNA Polymerase ence of DNA that controls gene expression G. binds an operator and stops gene expression in LAC operon by preventing RNA polymerase from binding gene and transcribing. H. Duplication of DNA in Sphase of Interphase 28. Codon 29. Transgenic 30. Recombinant DNA 31. PCR 32. 33 34. 35. 36. 37. 38. Plasmid Gene Therapy Gel electrophoresis DNA Profile DNA ligase GMO concern GMO benefit A. Analyzing STR patterns of blood or hair samples to solve crimes B....

  • Luestion 3 1 pts Review: You have the DNA that is radioactively labeled at the S'ends...

    Luestion 3 1 pts Review: You have the DNA that is radioactively labeled at the S'ends of DNA as shown below. But you want DNA that is labeled only at one end of the DNA, not both ends. One of the other undergraduate students in the lab suggests that you use a restriction enzyme to cut the DNA, then electrophorese the DNA in an agarose gel, then cut out the region of the gel with radioactive DNA fragment you want,...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT