Question

Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI DNA sequence B: ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC CGCCAGGCGGAACGCATGAGCCAGATT

Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI

DNA sequence B:
ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT
GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC
CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC
CGCCAGGCGGAACGCATGAGCCAGATTAAACGCCTGCTG
AGCGAAAAAAAAACCAGCCAGAGCCCGCATCGCTTTCAG
AAAACCCATAGCCCGATT

Primer Sequence C:
5’ CTGCTGCTGTTTATTGGC 3’

The first 20 amino acids in ‘Protein sequence A’ form a transmembrane helix. The remainder of the protein forms a globular cytoplasmic domain.

(i) Without copying out any sequence, describe the product you would expect to generate from a PCR reaction using ‘Primer sequence C’ as the forward primer, ‘DNA sequence B’ as the template and a reverse primer that matches the end of ‘DNA sequence B’? (2 marks)

(ii) Describe, without sequence, the protein this would encode. (2 marks)

(iii) Suggest a reason for cloning this product. (3 marks)

0 0
Add a comment Improve this question Transcribed image text
Answer #1

PCR is a technique used to amplified DNA fragments. For that, primer must be complement with a part of the DNA sequence. Two primers are necessary: a forward primer and a reverse primer. These two primers mark the beginning and the end of the DNA sequence to be copied.

In the example, primer sequence C does not much with DNA sequence B. As reverse primer does match the end of DNA sequence B, the final result of PCR would be copies of all the sequence. During PCR, enzyme would use reverse primer to copy all the DNA sequence B, without the limitation of the forward primer.

Add a comment
Know the answer?
Add Answer to:
Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI DNA sequence B: ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC CGCCAGGCGGAACGCATGAGCCAGATT
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • A1. The following is the DNA sequence of a hypothetical gene for the SMALL protein. It...

    A1. The following is the DNA sequence of a hypothetical gene for the SMALL protein. It is called the SMALL gene. i atgggattac actgtcacga ccaaatagcc ttcattgtat 41 caaaaggato aatcgagtta tag Imagine you are doing a research project in a laboratory and your supervisor asks you to clone the SMALL gene into the PBR322 plasmid (shown below). You must use the Pstl and EcoRI sites for your cloning. HindIII EcoRI | EcoRV BamHI 4359 0 29 185 4000 375 Sall Psti...

  • Explain why its the answer 1. Which amino acid sequence would most likely be for the...

    Explain why its the answer 1. Which amino acid sequence would most likely be for the transmembrane domain of a plasma membrane protein a) SKDTRENHQY b) KRHGPRKHRK C) DEWFDEESDT D)SFNQYCGQCN E) GAVMVAIGIL 36. What is the typical progression of steps in PCR reaction a) annealing of forward and reverse primers, denaturation of a DNA template, extension by a DNA polymerase using deoxyribonucleotides b) denaturation of a DNA template , annealing of forward and reverse primers, extension by a DNA polymerase...

  • design a forward and reverse PCR primer based on underlined sequence in the following DNA sequence....

    design a forward and reverse PCR primer based on underlined sequence in the following DNA sequence. 3' AAGCCAGGCCCTGGAGT......................TGGACTCGTGGGTGTG.....5' What does "PCR stand for and briefly describe PCR program

  • A peptide from a novel bacterial protein was isolated and sequenced. The amino acid sequence is...

    A peptide from a novel bacterial protein was isolated and sequenced. The amino acid sequence is NH2-Leu-Met-Pro-Tyr-Ser-Ala-Ala-Pro-Cys-Leu-Trp-Glu-Ala-Gly-Asp-Arg-COOH. To verify and clone the gene encoding this protein from this uncharacterized bacterium, a student has to purify the bacterial genomic DNA and use it as the template to isolate the DNA fragment that encodes this peptide using PCR. The student plans to design a pair of oligonucleotides as the forward and reverse primers to PCR the DNA fragment that encodes this peptide....

  • 3. Below is the template DNA sequence for a short human protein: Template DNA = 3’...

    3. Below is the template DNA sequence for a short human protein: Template DNA = 3’ GCATGACTATTAATACGTGCGCTACCAGACTTGA5’ A. How many amino acids will the protein translated from this mRNA have? B. How many nucleotides in total will be transcribed but not translated? Assume that the stop codon is not part of the untranslated region.

  • NEED HELP!! I am a little lost DNA Template Used in Forensic Identification: TATTGTACGG TACCATAAAT ACTTGACCAC...

    NEED HELP!! I am a little lost DNA Template Used in Forensic Identification: TATTGTACGG TACCATAAAT ACTTGACCAC CCACCATGAA CTGTAGTACA CCCATGCTTA TAAAAACCCA ATCCACATCA AAACCCCCTC CAAGCAAGTA CAGCAATCAA CCCCCCCTA CCTCACCCAC TCACACATCA АСТcccccтс CAAAGCCACC TAGGATACCA ACAAACCTAC CCACCAGGAA CAGTACATAG TACATAAAGC CATTTACCGT ACATAGCACA TTACAGTCAA АТсссттстс GTCCCCATGG ATGACCCCCC TCAGATAGGG Forward primer: Reverse primer: QAT Restriction Enzyme Recognition Sequence: 6CC GGS a) Label the 5' end of the template, primer, and restriction recognition sequences. 1 point b) Underline (on the above template sequence the primer binding sites. 1 point...

  • This sequence encodes a protein that you wish to study further by cloning the gene. The...

    This sequence encodes a protein that you wish to study further by cloning the gene. The protein of interest has a molecular weight of at least 10 kDa. The sequence was sequenced by a primer walking approach, but unfortunately the correct order of the sequence traces was lost (really bad lab notebook skills). Trace 1 aacgagttaaggagccagcgtaccttcgcaccgccatacatgaattttcttggctttttctatgtggatggcaatagtctagagtcggacctgcaggcatgcaag Trace 2 cagcctgttagtaggtcttactgagtcgggcgccgaattcgagctcggtacccggggatccatgagtgggcgccagttattcgtactattgggaggtcc Trace 3 ccgggtattttgtattcaatattgaataaggaatttttcatgcagagaaaaggatgtttacggctcgagcgcactcgcacatataactgtcggcagaaacgagttaaggagc Trace 4 tactattgggaggtccaaatggttttacgggagttgcactgggcgaatgctggagctattacgattcgtttaacatttccatatcgaattctcagacgactccgaatccgggtatttt Trace 5 cctgcaggcatgcaagcttggcataggtcagttcatccagggtgatgggtgtatcgtttcaatgacccgattcggaacg Answer the following-- Determine the correct order of the sequence traces and...

  • Below is a sequence of double-stranded DNA that will be used as a template in the...

    Below is a sequence of double-stranded DNA that will be used as a template in the polymerase chain reaction (PCR). The goal is to use this as a template to make a a PCR product that includes the shaded area. The sequence of one of the PCR primers is given below. Template DNA: 5' - CTTAGCGCTGTTGGGGGCCAACTATCACACACACCACACACAGGTATAAATGGCATTTGATACAGATTG - 3' 3' - GAATCTGTATCAAATGCCATTTATACCTGTGTGTGGTGTGTGTGATAGTTGGCCCCCAACAGCGCTAAG - 5' If the sequence of one of the primers is 5' TTGTGGGGCC 3' which of the following primers...

  • based on the given graph how would these be answered? sa sequence from a sheep PCR...

    based on the given graph how would these be answered? sa sequence from a sheep PCR product. The template used was genomic DNA and the forward and se primers were designed to amplify partofthe priongene, which encodes the causative agentot scrapie. is black;Cisblue; Ais green: Tisred. The forward primerwasusedasasequencing primer. TheNattheten ow means that the computer can't decide which nucleotide is at that position in the sequence because there are two peaks (red=T and blue-C) that are the same height....

  • Table 1B: Protein Synthesis with 2nd DNA Template Strand DNA Codons in the 2nd Template Strand...

    Table 1B: Protein Synthesis with 2nd DNA Template Strand DNA Codons in the 2nd Template Strand mRNA Sequence (List codons) Amino Acids in the Protein **Use the Genetic Code Chart on page 217 to determine the amino acids that will be placed in the protein Questions: 19. The three letter "code words of DNA and RNA that specify amino acids are called: A. codons B. promoters C. Introns D. anticodons 20. Proteins are composed of building blocks called: A. fatty...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT