Question

The basic structure of a gene contains which of the following? A) amino acids as specified...

The basic structure of a gene contains which of the following?

A) amino acids as specified by the DNA sequence

B) an origin of replication

C) a transcriptional termination site

D) a promoter

E) a site where sigma is released

0 0
Add a comment Improve this question Transcribed image text
Answer #1

The answer is

A) amino acids as specified by the DNA sequence

Explanation:

As per the central dogma mechanism DNA is replicated first and then it is transcribed into RNA and then the RNA is translated into protein. Amino acids are the monomers of proteins. The information to synthesise the amino acids which later gets modified into protein are present on the structure of a gene.

Add a comment
Know the answer?
Add Answer to:
The basic structure of a gene contains which of the following? A) amino acids as specified...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass trans...

    why is E the answer Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • Which of the following statements is true? A. RNA polymerase has a proofreading activity B. Prokaryotic...

    Which of the following statements is true? A. RNA polymerase has a proofreading activity B. Prokaryotic RNA usually undergoes nuclear processing C. Polypeptides are synthesized by addition of amino acids to the amino terminus. D. The 3' end of mRNA corresponds to the carboxyl terminus of the protein. Grade 2. Which of the following A. It may be autocatalytic. B. Spliceosomes are present in organelles and nuclei C. It involves removal of exons is true regarding RNA processing? D. It...

  • A cell that is heterozygous for a nonsense mutation in a tumor suppressor gene would most...

    A cell that is heterozygous for a nonsense mutation in a tumor suppressor gene would most likely: A) Group of answer choices B) grow but not divide C) have a normal cell cycle D) arrest and induce apoptosis E) have a slightly increased cell cycle and increased cell growth F) grow and divide uncontrollably Which of the following correctly describes an event that occurs during transcription: Group of answer choices A) A DNA molecule is chemically modified to become a...

  • 14.2 Modeling the Structure and Function of Nucleic Acids and Their Products 2. The following diagram...

    14.2 Modeling the Structure and Function of Nucleic Acids and Their Products 2. The following diagram represents some of the puzzle piece pieces used in this section. a Assembled in this form, do they represent an amino acid, c. a portion of messenger RNA, or a deoxyribonucleotide (b) Explain your answer. Opo 3. Why is DNA often called a double helix? 4. State the following ratios. (a) Guanine to cytosine in a double-stranded DNA molecule: (b) Adenine to thymine: -...

  • 26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysi...

    26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysine B) It is polar C) Forms disulfide bond/ cysteine D) Forms hydrogen bonds with neighbors/ alanine serine 27. All amino acids found in proteins are L-amino acids EXCEPT the achiral. A) glutamate B) Lysine C) glyeine D) Alamine 28. The plH at which the positive and negative charges of an amino acid balance each ofher is called the A) isotonic...

  • 1.What sequence upstream of AUG in prokaryotic mRNA facilitates recruitment of the 30S ribosomal subunit by...

    1.What sequence upstream of AUG in prokaryotic mRNA facilitates recruitment of the 30S ribosomal subunit by base pairing with 16S ribosomal RNA? A. The Pribnow box B. The Shine Dalgarno sequence C. The TATA box D. The -35 region E. A stop codon 2.What is the role of the Shine-Delgarno sequence in prokaryotic mRNAs? It specifies the site of translation initiation - ? It specifies the site of polyA addition RNA splicing RNA export It specifies the site of translation...

  • 3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the...

    3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the transcript: AUU UCU VUA GCA AGA GCU... Al The corresponding amino acids in the normal CFTR protein are: (Use either the one-or three-letter amino acid codes A naint mutation changes the last nucleotide from U to C. At the DNA level, this is a transition transversion c) At the protein level, this is a (silent / missense / nonsense/frameshift ) mutation. D) Instead of...

  • Uluruunu us RJ15 1. Draw or describe the process of eukaryotic transcription and translation, using the...

    Uluruunu us RJ15 1. Draw or describe the process of eukaryotic transcription and translation, using the following terms as needed (not all terms will be used): sigma factor, RNA polymerase, DNA polymerase, origin of replication, ribosome, start codon, transcriptional start site, stop codon, nucleus, -10 and -35 sequences, TATA box, TBP, inducer, transcriptional stop site, Shine-Delgrano sequence, Kozak sequence, RNA splicing. 2. Draw or describe the process of prokaryotic/eubacterial transcription and translation, using as many of the terms above as...

  • You wish to edit a gene in a population of stem cells using CRISPR/Cas9. You design...

    You wish to edit a gene in a population of stem cells using CRISPR/Cas9. You design a plasmid and transfect it into the cells. Your plasmid included the guide RNA sequence with promoter, the Cas9 gene inserted between an appropriate promoter and termination sequence, and the usual Origin of Replication and Resistance/Marker gene. However, instead of being edited, your target gene is silenced and its protein is not produced at all. What is the most likely explanation? The cells have...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT