What happens if the spliceosome makes a small mistake, such as inserting or deleting a single nucleotide from the final spliced mRNA?
- Can mutations in the DNA destroy a splice site? What is the consequence for the protein if and when this happens?
- Can mutations in the DNA create new splice sites? If so, what is the consequence for the protein?
Question
The spliceosome are the group of proteins which is involved in the removing introns from the pre-mRNA to form mRNA. The spliceosome is highly efficient in its function and produce mRNA that produce correct proteins needed by the cell to perform cellular function. But in case, if due to mistake , spliceosome either insert or delete one nucleotide, it lead to the formation of incorrect mRNA after splicing and that further lead to the formation of incorrect protein in the cell that lead to formation of many abnormal condition in the cell.
Yes, mutation in the DNA could destroy a splice site. This is because DNA is converted into RNA by transcription that futher change into the protein. If this mutation would occur, it would lead to the formation of incorrect protein or immature protein, therefore, it lead to the abnormal condition in the cell.
Yes, mutation in the DNA create new splice sites. If this mutation occur, it would lead to the formation of abnormal or immature protein
What happens if the spliceosome makes a small mistake, such as inserting or deleting a single...
why is E the answer
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...
What does the 5 prime cap on the mature mRNA consist of? (Choose all that apply) cap proteins backwards, methylated G nucleotide polyA tail ribosome QUESTION 7 Which DNA regions are necessary to specify removal of an intron? (choose all that apply) cleavage site branch point 5' splice site 3' splice site U-rich sequence QUESTION 9 Which of the following can permit a single gene to produce several different proteins? (choose all that apply) multiple 5' capping sites alternative splicing...
answer all the questions
18) A mutation occurs such that a spliceosome cannot remove one of the introns in a gene. What effect will this have on the gene? Translation will continue, but a nonfunctional protein will be made b) Translation will continue and will skip the intron sequence c) It will have no effect; the gene will be transcribed and translated into protein d) Transcription will terminate easily and the protein will not be made 19. During the process...
Cloning / Subcloning When subcloning engineering new plasmids, by inserting new DNA fragments (inserts) me plasmids (now called a vector because it will carry your gene of interest) it is important to considering existing genes / DNA elements. If a site is in the middle of a gene, you could lose or destroy that gene. If there are multiple sites for an enzyme, when you paste them together, multiple possible outcomes can arise. This is undesirable, because it confounds verification...
QUESTION 1: You are inserting a gene into an MCS found within the LacZ gene. Using blue/white colony selection, why could you assume that white colonies have modified plasmids? a. A blue colony means the LacZ reading-frame was disrupted b. A blue colony means your gene has mutations c. A white colony means the LacZ reading-frame is intact d. A white colony means the LacZ reading-frame was disrupted QUESTION 2: You are performing a PCR using primers with a sequence perfectly...
4. The CRISPR-Cas9 system is an important new technique in
molecular biology. What is the natural function of this system?
Describe how you would use this system to generate a null mutation
in another organism (i.e. explain Figure 6-43). How does it work?
What is the modification of the method that allows for correction
of a mutation (e.g. the mouse crystalline gene)? And lastly, what
are the problems with the CRISPR system?
FIGURE 6-43 Single-nucleotide mutations
can be introduced into...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
22. What are the roles of Dicer and RISC in the function of miRNAs? Dicer RISC 23. Describe the concepts of primary, secondary, tertiary and quaternary protein structure 24. Here is a short sequence of codons. AUG CAU UGU UUU Write out the amino acids this sequence of codons encodes. Now add an insertion mutation of your choosing in the first codon and write out the new mutant sequence. What are the first four amino acids encoded by this mutant...
13. Why are ribonucleoside triphosphates the monomers required for RNA synthesis rather than ribonucleoside monophosphates? A. Only ribonucleoside triphosphates contain the sugar ribose. B. Ribonucleoside triphosphates have low potential energy, making the polymerization reaction endergonic. C. Ribonucleoside triphosphates have high potential energy, making the polymerization reaction exergonic. D. Ribonucleoside monophosphates cannot form complementary base pairs with the DNA template. E. Ribonucleoside triphosphates are not used, rather all use deoxyriboside triphosphates. 14. How is a mutation in a bacterial cell that...
Please answer all questions. Some are a bit blurry but if you zoom
in you can read them. I need all of these to study. #21 all of the
following are required for polymerase 2 to operate,except
#22 site-specific recombinstion:
ATP h movement can involve either DNA or RNA elements betwees recombining molecules of seguence homology d almost ahways resuts in lethal mutacions 23. Poly-A tal of mRNA a added as soon as the 5 end emerges from the RNA...