1. A pentapeptide with antimicrobial properties is isolated from an annelid. Sequencing of this peptide revealed...
1. A pentapeptide with antimicrobial properties is isolated from an annelid. Sequencing of this peptide revealed the amino acid sequence: GYARC .
- What is the net charge of the peptide at the following pH values? Explain your answers using the chemical structure of the peptide.
- pH= 2 b) pH 7.5 c) pH 10.5
Homework Answers
Add Answer to:
1. A pentapeptide with antimicrobial properties is isolated from
an annelid. Sequencing of this peptide revealed...
c) You place your pentapeptide into a buffer with a pH=4. What direction will your pentapeptide...
c) You place your pentapeptide into a buffer with a pH=4. What direction will your pentapeptide move: Circle the correct answer. (2 marks) It will not move. Towards the positive electrode Towards the negative electrode Briefly Explain why: (2 marks) d) You are trying to separate 2 other peptides from your pentapeptide. Peptide 1 is made up of the amino acids: ARKS Peptide 2 is made up of the amino acids: ADES At what pH would you be able to...
What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is...
What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is the Isoelectric point (pI) of the peptide given above? Use the pKa values given here when needed: Side group/ amino acid pKa Asp 3.9 Glu 4.1 HIs 6.0 Cys 8.4 Tyr 10.5 Lys 10.5 Arg 12.5 C-term 3.5 N-term 9.0
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
#1) For the following pentapeptide (Where pH =1): a) What would the net charge be for...
#1) For the following pentapeptide (Where pH =1):
a) What would the net charge be for the following pH?
pH 0 =
pH 3 =
pH 5 =
pH 7 =
pH 10 =
pH 13 =
b) Calculate the pl of the pentapeptide. (Cysteine: pK1 = 1.96,
pK2 = 10.128) ( Glutamine: pK1 = 2.17 , pK2 = 9.13) (Arginine: pK1
= 2.17. pK2 = 9.04) (Leucine: pK1 = 2.36 , pK2 = 9.60)
c) If you were to...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not migrate in an electric field. Since the peptide is zwitterionic, there are the same number of positive charges as negative charges on the peptide population. The pI can be estimated fairly accurately (within 0.1 or 0.2 pH units) from the pK values of all the proton dissociable groups in the peptide. Using pK values from the table at the right, estimate the pI value...
1. An HEXAPEPTIDE was sequenced using differing enzyme and chemical reagents. The results of these experiments,...
1. An HEXAPEPTIDE was sequenced using differing enzyme and chemical reagents. The results of these experiments, along with an explanation of how to interpret the results, are provided below. Using this information, provide the 1˚ structure for this HEXAPEPTIDE. For the answer, be sure to include the following: A. Work/answers for Points B-F. B. The final sequence using 1 letter abbreviations for each amino acid. C. The structure of the final peptide drawn in MarvinSketch. Results from Sequencing Experiments on...
please answer thoroughly and correctly thjs js my last try Vasopressin is a peptide hormone synthesized...
please answer thoroughly and correctly thjs js my last try
Vasopressin is a peptide hormone synthesized by the hypothalamus; in its reduced form it has the structure shown. NH2 HS H H₂N н NH2 SH H NH2 OH Vasopressin NH *H N NH2 This structure is incorrect in that one of the amino acids is shown in the D-configuration, rather than the L. Which one is it? What is the amino acid sequence of this peptide? CYFONCPRG Enter your answer...
A peptide from a novel bacterial protein was isolated and sequenced. The amino acid sequence is...
A peptide from a novel bacterial protein was isolated and sequenced. The amino acid sequence is NH2-Leu-Met-Pro-Tyr-Ser-Ala-Ala-Pro-Cys-Leu-Trp-Glu-Ala-Gly-Asp-Arg-COOH. To verify and clone the gene encoding this protein from this uncharacterized bacterium, a student has to purify the bacterial genomic DNA and use it as the template to isolate the DNA fragment that encodes this peptide using PCR. The student plans to design a pair of oligonucleotides as the forward and reverse primers to PCR the DNA fragment that encodes this peptide....
c) You place your pentapeptide into a buffer with a pH=4. What direction will your pentapeptide move: Circle the correct answer. (2 marks) It will not move. Towards the positive electrode Towards the negative electrode Briefly Explain why: (2 marks) d) You are trying to separate 2 other peptides from your pentapeptide. Peptide 1 is made up of the amino acids: ARKS Peptide 2 is made up of the amino acids: ADES At what pH would you be able to...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
#1) For the following pentapeptide (Where pH =1):
a) What would the net charge be for the following pH?
pH 0 =
pH 3 =
pH 5 =
pH 7 =
pH 10 =
pH 13 =
b) Calculate the pl of the pentapeptide. (Cysteine: pK1 = 1.96,
pK2 = 10.128) ( Glutamine: pK1 = 2.17 , pK2 = 9.13) (Arginine: pK1
= 2.17. pK2 = 9.04) (Leucine: pK1 = 2.36 , pK2 = 9.60)
c) If you were to...
please answer thoroughly and correctly thjs js my last try
Vasopressin is a peptide hormone synthesized by the hypothalamus; in its reduced form it has the structure shown. NH2 HS H H₂N н NH2 SH H NH2 OH Vasopressin NH *H N NH2 This structure is incorrect in that one of the amino acids is shown in the D-configuration, rather than the L. Which one is it? What is the amino acid sequence of this peptide? CYFONCPRG Enter your answer...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 10 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 10 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 10 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 10 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 10 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 10 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 10 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 10 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 10 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 10 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 10 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 10 months ago