Answer:
According to data-
Answer 1:
Answer 2:
5’-...CTCGAGCCACGCGAAGCTTCAGG...-3’
Target PAM
Answer 3:
Cas9 cleaves 3 nucleotides upstream of the PAM sequence.

Answer 4:
Guide RNA sequence that is complementary to the target sequence
3’-GAGCUCGGTGCGCUUCGAAG-5’
-------------------------------------------------------###########################------------------------------------------------------ please give me positive vote
PART 3: Designing a Guide RNA You will now design your own guide RNA to inactivate...
3. The partial gene (DNA) sequence below contains multiple PAM sequences. Highlight six PAM sequences in the top (5' to 3) strand. 5'-GCACGGCGGAGCGGTTCTTGGCAGCGGCCGCACGATCTCGTTGCCGCCGG- 3' 3-CGTGCCGCCTCGCCAAGAACCGTCGCCGGCGTGCTAGAGCAACGGCGGCC- 5' Once Cas9 binds to a PAM sequence, it unwinds the DNA. If the guide RNA matches the DNA sequence next to the PAM, the guide RNA will bind to the complementary DNA strand. If not, the DNA will zip back together and Cas9 will keep binding to other PAM sequences until it finds the...
Please have a different answer than the other post, and use
layman's terms as well
hhmi Biolnteractive Using CRISPR to identify the Functions of Butterfly Genes Activity Student Handout This document is made available by the Howard Hughes Medical Institute. Using this document, you agree to use this document in accordance with the Terms of Use. INTRODUCTION Scientists have determined the complete DNA sequences of the genomes for many organisms, including humans. By analyzing patterns in those sequences, they can...
1) You have two human liver cells (A and B) and you hypothesize that the insulin receptor gene in Cell A has a mutation in exon 1 and Cell B contains the wild type sequence. You extract genomic DNA from each of the cells. Of the following, what would be the most efficient (quick, precise and relatively cheap) way to test your hypothesis. a. Isolate protein from both cells, purify the insulin receptor, and determine the amino acid content. b. Sequence the...
Below is a portion of DNA sequence, introns are shown in bold. Determine which strand contains a start codon and could serve as the template for synthesis of an mRNA molecule. 5’ ATCGCGCTCAGCTAGTACCGATCAGCAGTCAGCAGTCAGCATCGGT 3’ (top) 3’ TAGCGCGAGTCGATCATGGCTAGTCGTCAGTCGTCAGTCGTAGCCA 5’ (bottom) a. Which strand will serve as the template strand for transcription? b. Based on the template strand you have chosen, write the mature mRNA sequence on your answer sheet in the 5’ to 3’ direction. Be sure to label 5’ and...
where does transcription begin
3. List the major types of RNA and include what they code for, their function in the cell and which type is translated. 4. If a bacterial protein has 2,500 amino acids long, how many nucleotide pairs long is the ger sequence that codes for it? 5. Where does transcription begin? 6. What is the template and nontemplate strands of DNA? 7. Why is only one strand transcribed, and is the same strand of DNA always...
6a) You want to use homologous recombination to generate a mouse that does not express a functional XPC gene (‘Knock-out’ or KO). To do this, you want to delete exon 10 and replace it with a gene that confers resistance to the drug Neomycin (NEO. The usual second selection with tk we discussed in class is not shown here). Using the diagram as a guide: illustrate on the diagram where you expect crossing over to occur and (below the diagram)...
Can someone please help with these two questions? Thank you.
4. Here is an RNA transcript freshly transcribed from a gene. It is immature, meaning that it has not been processed yet into a mature mRNA. a) If you could zoom in on this molecule, what two things would you observe at the molecular level that would indicate to you that it is RNA and not DNA? b) Which end of the molecule was the last bit to be transcribed,...
please help answer these questions
3. What are the similarities, differences, advantages, and disadvantages of CRISPR-based gene editing versus Zinc-finger nucleases and TALENS? 4. What is crRNA and what does it do? 5. What is tracrRNA and what does it do? 6. What is the PAM sequence and what is its significance? 7. What can nuclease-deficient Cas9 (acas) proteins be used for? 8. You want to insert DNA encoding an epitope tag to the end of a specific gene you...
2) On your first day working in my lab, you obtain the following DNA sequence: 3' AATTATACACGATGAAGCTTGTGACAGGTTTCCAATCATTAA 5 5' TTAATATGTGCTACTTCGAACACTGTECCAAAGGTTAGTAATT 3' a) What are the two possible RNA molecules that could be transcribed from this DNA? Indicate the 5' and 3' ends of the RNA. b) Only one of these two RNA molecules can actually be translated. Explain why. c) It turns out that the RNA molecule that can be translated is the mRNA for p53. What is the amino...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...