>XP_001758837.1
MASSSRALYLFIFSLALCHSVNAGMSNVEKIQLAFKQITTASDNLRKETQLINIINAPLQGSKIAEGFAK IISAIAEYTIKINEGGVKNDNSPLPDADAKLVVQSLTTFVQVHQALLNVVIGKHGLLTLIPFFEPIRLSL VSLEATIDAFAFALIAEIPTQKPAADVQFGSLSVTLQVAITTYSSPLAKLGETMKEIAISA
1. Please use this sequence as query and perform a regular BLAST search of NCBI protein sequences.
Which BLAST program do you need to use?
protein protein BLAST (blastp) can be used for this given sequence for BLAST with NCBI protein.blasp is used for align query protein data with protein data of NCBI.
>XP_001758837.1 MASSSRALYLFIFSLALCHSVNAGMSNVEKIQLAFKQITTASDNLRKETQLINIINAPLQGSKIAEGFAK IISAIAEYTIKINEGGVKNDNSPLPDADAKLVVQSLTTFVQVHQALLNVVIGKHGLLTLIPFFEPIRLSL VSLEATIDAFAFALIAEIPTQKPAADVQFGSLSVTLQVAITTYSSPLAKLGETMKEIAISA 1. Please use this sequence as
Use BLAST to find DNA sequences in databases Perform a BLAST search as follows: Do an Internet search for “ncbi blast”. Click on the link for the result: BLAST: Basic Local Alignment Search Tool. Under the heading “Basic BLAST,” click on “nucleotide blast”. pMCT118_F 5’- GAAACTGGCCTCCAAACACTGCCCGCCG -3’ (forward primer) pMCT118_R 5’- GTCTTGTTGGAGATGCACGTGCCCCTTGC -3’ (reverse primer) Enter the pMCT118 primer (query) into the search window. (see Moodle metacourse page for the file – just copy and paste the sequence into the...
PDB BLAST, NCBI BLAST, and KEGG all use E values to describe the sequences matching the query. How does the E value differ (if at all) between these programs? Explain your answer. Throughout these lab exercises you have analyzed sequences using protein BLAST (pBLAST) through NCBI, the PDB, and KEGG. How do these BLAST programs differ from one another, if at all? Explain your answer.
We will refer to the protein as sequence2. It was just 40 amino acids long and had the following amino acid sequence >sequence2 MSAEALADPAADPLAGNNPDADPEAINLKAIAALAKALLG Using your knowledge of BLAST searching particularly “Protein BLAST” (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome), the Expasy (http://www.expasy.org/) and the BLASTP align2seq (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=blast2seq&LINK_LOC=align2seq ) Answer the following questions: a) What is the identity score between the query protein sequence (i.e. sequence2) and the highest scoring (best) aligning sequence from the BLAST search? (1 mark) b) Using similarity to other species as...
x Assignment 1 - Database.pdf ... Learn how to access and use NCBI databases Question 1: Search Taxonomy database for: 1) Homo sapiens, 2) Heterodoxus macropus, 3) E. coli. a. What is the common name of the species? b. How many nucleotide or protein sequence records do you find (show your search results in cropped windows)? Question 2: Use the name "plague thrips" to search the Nucleotide database. a. What is the scientific name of the plague thrips? b. How...
To use the Basic Local Alignment Search Tool (BLAST) for the NCBI website, you will first need to have A. a nucleotide sequence B. mRNA converted to cDNA C. a polypeptide (amino acid) sequence D. any one of the above
Using the National Center for Biotechnology Information Web site () find the sequence of the enzyme triose phosphate isomerase from E. coli. Use this sequence as a query for a protein-protein BLAST search. In the output, find the alignment with the sequence of triose phosphate isomerase from human beings (Homo sapiens). How many identities are observed in the alignment?
Question 9 (1 point) What is this zebrafish (Danio rerio) sequence? Copy it and go to NCBI nucleotide BLAST and analyze it. You should be able to copy the sequence with your word processor and copy it into BLAST: gcccaagaag gattctccta aggttcaaca tggcgttaag gttgtgtctg agccttcctc tcctgttcct atggagacct ccggctgtgc ttcagatgat ctgtgtcaag cattctctga Danio rerio cyclin B1 Danio rerio cell division cycle 20 homolog Danio rerio cadherin 1, E-cadherin (cdh1) Danio rerio Cdh2 Danio rerio F-box protein 5 O Danio rerio WEE1...
Use the following information to answer the questions below. You have isolated a gene sequence from the mustard plant Arabidopsis and have BLAST searched the NCBI database. Your sequence hit several EST sequences that were identified as transcription factors. These sequences were found in E.coli, Chlamydomonas (a green algae), yeast, mice, and humans and only had a few base pair differences. What can be surmised about your transcription factor? It is unique to Arabidopsis. It is likely involved in a...
QUESTIONS 1) Do a BLASTP search using RBP4 (NP_006735), restricting the output to Arthropoda (Insects). How many databases matches have an Evalue less than 0.01 in this search? (10 points) 2) Next, do a BLASTN search using the RBP4 nucleotide sequence (NM_006744). For this query, select only the nucleotides corresponding to the coding region of the DNA. (To do this visit the NCBI Nucleotide page, follow the link to the coding sequence [CDS), then choose the FASTA format.) How many...
BINF4000 chapter 7, question 6 You have a protein sequence and you want to know iis structure in a short time. you perform BLAST and PSI-BLAST searches of the PDB and you find a sequence with 15% amino acid identity to your protein. The e-value is .5. Which of the following options would you choose to achieve your goal. A. Use X-ray crystallography B. Use NMR spectroscopy C. Submit your sequence to a protein structure prediction server that performs homology...