Question

Based on the following picture:

1- Write the DNA sequence of the recombinant pET/GFP plasmid beginning at the ATG translational start codon and continuing through the first 4 codons (triplets) of the GFP coding region. Put a box around the NheI site.1-

2- Also, based on the DNA sequence you have written out above, write the amino acid sequence of the protein that is encoded by this DNA. Box the His-tag. Underline the region that corresponds to the GFP protein sequence.

Indicate the start site of transcription from the region of the pET28 vector drawn above, indicate the position of the translational start codon, and indicate the position where did cut this vector to insert DNA that contains the coding region of GFP?

Tarometer T7 promoter Lac operator la creator o Xbal r as | History RBS His-tag Nhel Model EcoRI

0 0
Add a comment Improve this question Transcribed image text
Answer #1

T7 PROMOTER LAC OPERATOR XBA1 RBS

TTAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTTTAACTTTAAGAA

HISTAG NHE1

GGAGA TATACCATGGGCAGCAGCCATCATCATCATCATCAGCTAGCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAAGAATTC

ECOR1

HISTAG GFP

2.MGSSHHHHHASMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKQF

3.T7 PROMOTER is the transcription start site ...and MGSS is the translation start site .To clone the dna in PET2

Add a comment
Know the answer?
Add Answer to:
Based on the following picture: 1- Write the DNA sequence of the recombinant pET/GFP plasmid beginning...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • the map of the pGPF is provided. Below is a map for a plasmid called 'pGEP: 5 MCS 1234-281 AlwN I 28111 pUC orl GFP pGFP 3.3 kb AlveN 1 190의 3 MCS (1005-1098 Amp Pvul Aat II (1413) The se...

    the map of the pGPF is provided. Below is a map for a plasmid called 'pGEP: 5 MCS 1234-281 AlwN I 28111 pUC orl GFP pGFP 3.3 kb AlveN 1 190의 3 MCS (1005-1098 Amp Pvul Aat II (1413) The sequence (5' to 3) of pGEP containing the promoter region, the 5' multiple cloning site (with a Bamil site, underlined), and the 5' end of the GFP coding sequence is as follows: 6: ACGACAGGTT TCCCGACTCG AAACCGCCCA GTGAGCOCAA COCAATTAATCTGAGTTAGE ITTGTGAGEGG ATAACAATTI...

  • A1. The following is the DNA sequence of a hypothetical gene for the SMALL protein. It...

    A1. The following is the DNA sequence of a hypothetical gene for the SMALL protein. It is called the SMALL gene. i atgggattac actgtcacga ccaaatagcc ttcattgtat 41 caaaaggato aatcgagtta tag Imagine you are doing a research project in a laboratory and your supervisor asks you to clone the SMALL gene into the PBR322 plasmid (shown below). You must use the Pstl and EcoRI sites for your cloning. HindIII EcoRI | EcoRV BamHI 4359 0 29 185 4000 375 Sall Psti...

  • ASSIGNMENT For the DNA sequence given below, write the complementary DNA sequence that would complete the...

    ASSIGNMENT For the DNA sequence given below, write the complementary DNA sequence that would complete the double-strand.   DNA    3’—A   T   T  G   C   T   T   A  C   T   T  G   C   A   T -- 5’ DNA    5’-- Does it matter which strand is the ‘code strand’? The following two sequences look identical, except one runs 3’-5’ and the other 5’-3’. For each DNA sequence given below, write the mRNA sequence that would be coded from it. Make sure you indicate the direction of each mRNA strand (i.e. 3’ and 5’ ends).  Use the Universal triplet code to...

  • The following DNA sequence contains a bacterial gene: 1. Copy the above sequence and indicate on...

    The following DNA sequence contains a bacterial gene: 1. Copy the above sequence and indicate on it the: a. -10 and -35 promoter region b. Ribosome binding site c. Stop codon (and whether it is an amber, opal or ochre codon), d. Transcriptional terminator. e. Note the atg start site has been marked and the gene is indicated in italics 2. Is the promoter a strong or weak promoter? Why? 3. Is the terminator a Rho dependent or Rho independent...

  • Chromosomal and plasmid DNA can be cut into manageable pieces by restriction enzymes. Using agarose gel...

    Chromosomal and plasmid DNA can be cut into manageable pieces by restriction enzymes. Using agarose gel electrophoresis, the DNA fragments can be separated on a gel, based on their lengths. In order to see the fragments, a stain is typically added to the gel. The size of each fragment can be determined by comparing each one to a DNA molecular weight marker of known size. Below is a map of pBR22 plasmid. The position and base pair number of the...

  • The following genomic DNA sequence comes from the first exon of a human gene and contains...

    The following genomic DNA sequence comes from the first exon of a human gene and contains the 3'-end of the 5'-untranslated region and the start of a long open reading frame that codes for 200 amino acids (a.k.a. coding sequence). Note: There are no introns in this short portion and only one strand of the genomic DNA is shown. Which of the following answers lists the first three amino acids of the translated protein correctly? Seconed Position tyr ser leu...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT