write a flowchart searching sequence protocol using a pair of DNA sequences of vioB gene isolated...
write a flowchart searching sequence protocol using a pair of DNA sequences of vioB gene isolated from chromobacterium violaceum based on
i ) its translation and
ii ) potential open reading frame,
iii ) the family it belongs to,
iv ) its function and
v ) structural forms.
( 12 marks ) please show clear and complete answers tq
Homework Answers
All the data is obtained from the Uniprot database.
Protein: 2-imino-3-(indol-3-yl)propanoate dimerase
Gene: vioB
Organism: Chromobacterium violaceum
Family and domain databases:
Gene3D: 1.20.1260.10
InterPro:IPR030993 VioB
TIGRFAMs: TIGR04492 VioB
Phylogenomic databases
eggNOG: ENOG4106I9T Bacteria
HOGENOM: HOG000014632
KO: K20087
OMA: IAHEEMI
OrthoDB: POG091H0D65
>Protein sequence
MSILDFPRIHFRGWARVNAPTANRDPHGHIDMASNTVAMAGEPFDLARHPTEFHRHLRSL
GPRFGLDGRADPEGPFSLAEGYNAAGNNHFSWESATVSHVQWDGGEADRGDGLVGARLAL
WGHYNDYLRTTFNRARWVDSDPTRRDAAQIYAGQFTISPAGAGPGTPWLFTADIDDSHGA
RWTRGGHIAERGGHFLDEEFGLARLFQFSVPKDHPHFLFHPGPFDSEAWRRLQLALEDDD
VLGLTVQYALFNMSTPPQPNSPVFHDMVGVVGLWRRGELASYPAGRLLRPRQPGLGDLTL
RVSGGRVALNLACAIPFSTRAAQPSAPDRLTPDLGAKLPLGDLLLRDEDGALLARVPQAL
YQDYWTNHGIVDLPLLREPRGSLTLSSELAEWREQDWVTQSDASNLYLEAPDRRHGRFFP
ESIALRSYFRGEARARPDIPHRIEGMGLVGVESRQDGDAAEWRLTGLRPGPARIVLDDGA
EAIPLRVLPDDWALDDATVEEVDYAFLYRHVMAYYELVYPFMSDKVFSLADRCKCETYAR
LMWQMCDPQNRNKSYYMPSTRELSAPKARLFLKYLAHVEGQARLQAPPPAGPARIESKAQ
LAAELRKAVDLELSVMLQYLYAAYSIPNYAQGQQRVRDGAWTAEQLQLACGSGDRRRDGG
IRAALLEIAHEEMIHYLVVNNLLMALGEPFYAGVPLMGEAARQAFGLDTEFALEPFSEST
LARFVRLEWPHFIPAPGKSIADCYAAIRQAFLDLPDLFGGEAGKRGGEHHLFLNELTNRA
HPGYQLEVFDRDSALFGIAFVTDQGEGGALDSPHYEHSHFQRLREMSARIMAQSAPFEPA
LPALRNPVLDESPGCQRVADGRARALMALYQGVYELMFAMMAQHFAVKPLGSLRRSRLMN
AAIDLMTGLLRPLSCALMNLPSGIAGRTAGPPLPGPVDTRSYDDYALGCRMLARRCERLL
EQASMLEPGWLPDAQMELLDFYRRQMLDLACGKLSREA
>Genomic sequence
ATGAGCATTCTGGATTTTCCACGCATCCATTTCCGCGGCTGGGCGCGGGTCAACGCGCCCACCGCCAACC
GCGATCCGCACGGCCACATCGACATGGCCAGCAATACGGTGGCCATGGCAGGCGAACCGTTCGACCTCGC
GCGCCATCCGACCGAGTTCCACCGCCACCTGCGGTCGCTGGGGCCGCGTTTCGGCCTGGACGGCCGGGCT
GACCCGGAAGGGCCGTTCAGCCTGGCCGAGGGCTACAACGCGGCCGGCAACAACCATTTCTCCTGGGAGA
GCGCCACCGTCAGCCACGTGCAGTGGGATGGCGGCGAAGCGGACCGCGGCGACGGCCTGGTCGGCGCCAG
GCTGGCGCTGTGGGGGCATTACAACGATTACCTGCGCACCACCTTCAACCGCGCGCGCTGGGTGGACAGC
GACCCCACCCGCCGCGACGCGGCGCAGATCTACGCCGGGCAGTTCACGATCAGCCCGGCCGGCGCCGGAC
CGGGCACGCCCTGGCTGTTCACCGCCGACATCGACGACAGCCACGGCGCGCGCTGGACGCGCGGCGGCCA
CATCGCCGAGCGCGGCGGCCATTTCCTGGACGAGGAGTTCGGCCTGGCGCGGCTGTTCCAGTTCTCGGTG
CCCAAAGACCATCCGCACTTCCTGTTCCACCCGGGGCCATTCGATTCCGAAGCCTGGCGCAGGCTGCAGC
TGGCGCTGGAGGACGACGACGTGCTCGGCCTGACGGTGCAGTACGCGCTGTTCAATATGTCGACGCCGCC
GCAACCCAACTCGCCGGTGTTCCACGACATGGTCGGCGTGGTCGGCCTGTGGCGGCGCGGCGAACTGGCC
AGCTACCCGGCCGGCCGGCTGCTGCGTCCGCGCCAGCCCGGGCTGGGCGATCTGACGCTGCGCGTAAGCG
GCGGCCGCGTGGCGCTGAATCTGGCCTGCGCCATTCCGTTCTCCACCCGGGCGGCGCAGCCGTCCGCGCC
GGACAGGCTGACGCCCGATCTCGGGGCCAAGCTGCCGTTGGGCGACCTGCTGCTGCGCGACGAGGACGGC
GCGTTGCTGGCGCGGGTGCCGCAGGCGCTTTACCAGGATTACTGGACGAACCACGGCATCGTCGACCTGC
CGCTGCTGCGCGAGCCCAGGGGCTCGCTGACGCTGTCCAGCGAGCTGGCCGAATGGCGCGAGCAGGACTG
GGTCACGCAGTCCGACGCCTCCAATCTTTATTTGGAAGCGCCGGACCGCCGCCACGGCCGTTTCTTTCCG
GAAAGCATCGCGCTGCGCAGCTATTTCCGCGGCGAGGCCCGCGCGCGCCCGGACATTCCCCACCGGATCG
AGGGGATGGGTCTGGTCGGCGTGGAGTCGCGCCAGGACGGCGATGCCGCCGAATGGCGGCTGACCGGCCT
GCGGCCCGGCCCGGCGCGCATCGTGCTCGACGACGGCGCGGAGGCGATCCCGCTGCGGGTGCTGCCGGAC
GACTGGGCGTTGGACGACGCGACGGTGGAGGAGGTCGATTACGCCTTCCTGTACCGGCACGTGATGGCCT
ATTACGAGCTGGTCTACCCGTTCATGTCCGACAAGGTGTTCAGCCTGGCCGACCGCTGCAAGTGCGAGAC
CTACGCCAGGCTGATGTGGCAGATGTGCGATCCGCAGAACCGGAACAAGAGCTACTACATGCCCAGCACC
CGCGAGCTGTCGGCGCCCAAGGCCAGGCTGTTCCTCAAATACCTGGCCCATGTCGAGGGCCAGGCCAGGC
TGCAGGCGCCGCCGCCGGCCGGGCCGGCGCGCATCGAGAGCAAGGCCCAGCTGGCGGCCGAGCTGCGCAA
GGCGGTGGATCTGGAGTTGTCGGTGATGCTGCAGTACCTGTACGCCGCCTATTCCATTCCCAATTACGCC
CAGGGCCAGCAGCGGGTGCGCGACGGCGCGTGGACGGCGGAGCAGCTGCAGCTGGCCTGCGGCAGCGGCG
ACCGGCGCCGCGACGGCGGCATCCGCGCCGCGCTGCTGGAGATCGCCCACGAGGAGATGATCCATTACCT
GGTGGTCAACAACCTGCTGATGGCGCTGGGCGAGCCGTTCTACGCCGGCGTGCCGCTGATGGGCGAGGCG
GCGCGGCAGGCGTTCGGCCTGGACACCGAATTCGCGCTGGAGCCGTTCTCCGAGTCGACGCTGGCGCGCT
TCGTCCGGCTGGAATGGCCGCACTTCATCCCTGCGCCGGGCAAATCCATCGCCGACTGCTACGCCGCCAT
CCGCCAGGCCTTTCTCGATCTGCCCGACCTGTTCGGCGGCGAGGCCGGCAAGCGCGGCGGCGAGCACCAC
TTGTTCCTCAACGAGCTGACCAACCGCGCCCATCCCGGCTACCAGCTGGAGGTGTTCGATCGCGACAGCG
CGCTGTTCGGCATCGCCTTCGTCACCGACCAGGGCGAGGGCGGGGCGCTGGACTCGCCGCATTACGAGCA
TTCGCATTTCCAGCGGCTGCGGGAGATGTCGGCCAGGATCATGGCGCAGTCCGCGCCGTTCGAGCCGGCG
TTGCCGGCGCTGCGCAACCCGGTGCTGGACGAGTCGCCGGGCTGCCAGCGCGTGGCGGACGGACGGGCGC
GCGCGCTGATGGCGCTGTACCAGGGCGTGTACGAGCTGATGTTCGCGATGATGGCGCAGCACTTCGCGGT
CAAGCCGCTGGGCAGCCTCAGGCGCTCGCGGCTGATGAACGCGGCGATCGACCTGATGACCGGCCTGCTC
AGGCCGCTGTCCTGCGCGCTGATGAACCTGCCGTCGGGCATCGCCGGACGCACCGCCGGGCCGCCGCTGC
CGGGGCCGGTGGATACCCGCAGCTACGACGACTACGCGCTGGGCTGCCGGATGCTGGCGCGGCGCTGCGA
GCGCCTGCTGGAGCAGGCGTCGATGCTGGAGCCGGGCTGGCTGCCCGACGCGCAAATGGAACTGCTGGAT
TTCTACCGCCGGCAGATGCTGGATTTGGCTTGTGGAAAGCTTTCTAGAGAGGCCTGA
Add Answer to:
write a flowchart searching sequence protocol using a pair
of DNA sequences of vioB gene isolated...
Can someone outline how I would go from my DNA sequence to my final product of...
Can someone outline how I would go from my DNA sequence to my
final product of coding the amino acids. I am confused on the
complimenting strands and which ones I would need.
Below is the coding sequence of very small prokaryotic gene. The coding sequence is shown in red while the regulatory sequences are shown in black and the UTR in blue. The underlined sequences denote the -10 sequence. The arrow marks the point of a 5 base insertion...
7. Open reading frames A protein coding gene includes the following sequence on one of its...
7. Open reading frames A protein coding gene includes the following sequence on one of its two DNA strands. Note that this segment (within an exon) does NOT include either the start codon or the stop codon for this gene. However, because five of the six potential reading frames (3 on each DNA strand) in this region include stops, only the true reading frame remains "open" through this segment. Therefore, it is possible to unambiguously decode (translate) this segment of...
Augu Q46. Below is a DNA sequence from a yeast GPCR gene. Using RNA sequencing methods...
Augu Q46. Below is a DNA sequence from a yeast GPCR gene. Using RNA sequencing methods you have obtained the following partial 5' sequence for the MRNA transcribed from this gene: 5'-GGUCCAU... 5'GTATAAGAAGCACTCTACCTCAATGGGTCCATGGGAGAAGGTAGGCATGTGTATTTGACAAAGGGA i. What are the most likely six N-terminal amino acids for the above gene? (2 pts) Examine the other reading frames. Explain why you can exclude those other possible reading frames from consideration (one or two reasons depending upon the frame). (2 pts) Circle the portion of...
This DNA sequence comes from part of a gene on a chromosome of a eukaryotic organism.
This DNA sequence comes from part of a gene on a chromosome of a eukaryotic organism. i) If the bottom strand of the sequence is the template strand and the top strand is the coding strand, circle the answer below that best represents the direction that RNA polymerase would move along the template DNA strand. Left to Right Right to Left Lagging to Leading A site to P site ii) Given the information in 6 i, write the sequence of the mRNA...
I. Use the DNA sequence below, which encodes a prokaryotic gene to answer the following questions....
I. Use the DNA sequence below, which encodes a prokaryotic gene to answer the following questions. 11 21 31 41 51 71 81 61 91 CGTAATTGAG GAGGTAGTTG ACGTATGAAT AGTTAACGTA CGGGGGGGAA 101 111 121 131 141 ACCCCCCCTT TTTTTTTTTC GAGCAATAAA AGGGTTACAG ATTGCATGCT a) Write down the corresponding sequences, find them in the sequence above and label them: -35 Consensus sequence: _(label as -35) -10 Consensus sequence (Pribnow box): _ __ (label as Pribnow) Shine-Dalgarno sequence in corresponding mRNA: __ (label as SD)...
Chromosomal and plasmid DNA can be cut into manageable pieces by restriction enzymes. Using agarose gel...
Chromosomal and plasmid DNA can be cut into manageable pieces by
restriction enzymes. Using agarose gel electrophoresis, the DNA
fragments can be separated on a gel, based on their lengths. In
order to see the fragments, a stain is typically added to the gel.
The size of each fragment can be determined by comparing each one
to a DNA molecular weight marker of known size.
Below is a map of pBR22 plasmid. The position and base pair
number of the...
Part I— Just Bad Luck? Brrrring! Brrrring! Jane checked the caller ID on her phone. “Sam!...
Part I— Just Bad Luck? Brrrring! Brrrring! Jane checked the caller ID on her phone. “Sam! Great!” she thought. It was always nice to get a call from her older brother. But a little twinge of worry tugged at her. It was just a couple of weeks ago that he had mentioned making an appointment with his doctor about some abdominal pain he had been having. “Hi Sam! It’s great to hear from you,” Jane answered. “Hi Jane. Well I...
Please read the article bellow and discuss the shift in the company's approach to genetic analysis....
Please read the article bellow and discuss the shift in the
company's approach to genetic analysis. Please also discuss what
you think about personal genomic companies' approaches to research.
Feel free to compare 23andMe's polices on research with another
company's. Did you think the FDA was right in prohibiting 23andMe
from providing health information?
These are some sample talking points to get you thinking about
the ethics of genetic research in the context of Big Data. You
don't have to...
Can someone outline how I would go from my DNA sequence to my
final product of coding the amino acids. I am confused on the
complimenting strands and which ones I would need.
Below is the coding sequence of very small prokaryotic gene. The coding sequence is shown in red while the regulatory sequences are shown in black and the UTR in blue. The underlined sequences denote the -10 sequence. The arrow marks the point of a 5 base insertion...
7. Open reading frames A protein coding gene includes the following sequence on one of its two DNA strands. Note that this segment (within an exon) does NOT include either the start codon or the stop codon for this gene. However, because five of the six potential reading frames (3 on each DNA strand) in this region include stops, only the true reading frame remains "open" through this segment. Therefore, it is possible to unambiguously decode (translate) this segment of...
Augu Q46. Below is a DNA sequence from a yeast GPCR gene. Using RNA sequencing methods you have obtained the following partial 5' sequence for the MRNA transcribed from this gene: 5'-GGUCCAU... 5'GTATAAGAAGCACTCTACCTCAATGGGTCCATGGGAGAAGGTAGGCATGTGTATTTGACAAAGGGA i. What are the most likely six N-terminal amino acids for the above gene? (2 pts) Examine the other reading frames. Explain why you can exclude those other possible reading frames from consideration (one or two reasons depending upon the frame). (2 pts) Circle the portion of...
I. Use the DNA sequence below, which encodes a prokaryotic gene to answer the following questions. 11 21 31 41 51 71 81 61 91 CGTAATTGAG GAGGTAGTTG ACGTATGAAT AGTTAACGTA CGGGGGGGAA 101 111 121 131 141 ACCCCCCCTT TTTTTTTTTC GAGCAATAAA AGGGTTACAG ATTGCATGCT a) Write down the corresponding sequences, find them in the sequence above and label them: -35 Consensus sequence: _(label as -35) -10 Consensus sequence (Pribnow box): _ __ (label as Pribnow) Shine-Dalgarno sequence in corresponding mRNA: __ (label as SD)...
Chromosomal and plasmid DNA can be cut into manageable pieces by
restriction enzymes. Using agarose gel electrophoresis, the DNA
fragments can be separated on a gel, based on their lengths. In
order to see the fragments, a stain is typically added to the gel.
The size of each fragment can be determined by comparing each one
to a DNA molecular weight marker of known size.
Below is a map of pBR22 plasmid. The position and base pair
number of the...
Please read the article bellow and discuss the shift in the
company's approach to genetic analysis. Please also discuss what
you think about personal genomic companies' approaches to research.
Feel free to compare 23andMe's polices on research with another
company's. Did you think the FDA was right in prohibiting 23andMe
from providing health information?
These are some sample talking points to get you thinking about
the ethics of genetic research in the context of Big Data. You
don't have to...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 10 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 10 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 10 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 10 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 10 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 10 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 10 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 10 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 10 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 10 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 10 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 10 months ago