Question

Suppose that a mutation occurs in an intron of a gene encoding a protein. Explain what...

Suppose that a mutation occurs in an intron of a gene encoding a protein. Explain what effect this mutation will have on the protein’s amino acid sequence?

0 0
Add a comment Improve this question Transcribed image text
Answer #1

I believe the correct answer to be:

There will be NO EFFECT on the protein made from this sequence.

Because introns are ultimately spliced from the mRNA and hence are not used to create aminoacid chain. Only Exons are used as a template to create proteins.

feel free to leave a comment down below for any further query. good rating would be appreciated if you find my answer helpful. thank you.

Add a comment
Know the answer?
Add Answer to:
Suppose that a mutation occurs in an intron of a gene encoding a protein. Explain what...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • The gene encoding protein Bog in E. coli has been changed by a point mutation in...

    The gene encoding protein Bog in E. coli has been changed by a point mutation in its open reading frame. Originally the gene encoded a 108 amino acid long functioning protein whose amino acid composition favored nonpolar and negatively charged amino acids. After the mutation it encodes a 110 amino acid long non-functioning protein that is now rich in polar uncharged amino acids and positively charged amino acids. Which mutation scenario best explains this observation. A) A frame-shift caused by...

  • 5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon...

    5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon 3. The 5ʹ splice site at the boundary between exon 2 and intron 2 has been eliminated by a small deletion in the gene. Describe how the pre-mRNA encoded by this mutant gene would be spliced. Indicate which introns and exons would be found in the mRNA after splicing occurs

  • Suppose a mutation occurs in the gene encoding eukaryotic RNA polymerase I, II, or lll that...

    Suppose a mutation occurs in the gene encoding eukaryotic RNA polymerase I, II, or lll that renders that polymerase non-functional. Match each RNA polymerase mutation with all of the cellular processes that it would disrupt. Mutation in eukaryotic RNA polymerase I Mutation in eukaryotic RNA polymerase II Mutation in eukaryotic RNA polymerase III pre-mRNA processing RNA synthesispre-mRNA synthesis RNAi-mediated gene regulation IRNA synthesis mRNA translation rRNA processing

  • Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dyst...

    Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dystrophin. The dystrophin protein itself is 3684 amino acids in length. Calculate below the approximate size of the mRNA that encodes dystrophin. Approximately what percentage of the gene that encodes dystrophin is intron sequence? The human genome encodes a much greater variety and number of proteins than the...

  • DNA to Protein Describe the mutation that created the HbS allele: type of mutation, location of...

    DNA to Protein Describe the mutation that created the HbS allele: type of mutation, location of mutation on HbA sequence (# of bases from beginning of sequence), nucleotide change (from which base to which base?). Describe the effect of this mutation on amino acid sequence of beta-globin polypeptide chain: effect of mutation on codon, which amino acid was changed (# amino acids from beginning of chain), what was the amino acid change (from which amino acid to which amino acid?)...

  • Gene Mutation Worksheet 1. There are several types of gene mutations. (a) List two. (b) What...

    Gene Mutation Worksheet 1. There are several types of gene mutations. (a) List two. (b) What do they have in common? (c) How are they different? 2. A geneticist found that a particular DNA mutation had no effect on the protein coded by a gene. What kind of mutation was this? Why? 3. (a) Name one amino acid that has more than one codon. (b) Name an amino acid that has only one codon 4. Look at the following sequence:...

  • 1) Suppose that gene A 3,000 bp. Suppose that g contained within intron 1 opposite directions...

    1) Suppose that gene A 3,000 bp. Suppose that g contained within intron 1 opposite directions for the two genes. covers 10,000 base pairs (bp) and has 2 exons; the intron in gene A is ene B covers 1,500 bp and has two exons. Gene B is completely of gene A. The direction of the transcriptional bubble moves in A. Draw the genomic organization (i.e., exons and introns) of gene A AND gene B. Label the polarity of the DNA...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • The human protein coding gene frt has three exons. A mutation at the splice junction between...

    The human protein coding gene frt has three exons. A mutation at the splice junction between the second exon and first intron leads to an inability to remove a DNA segment during splicing. Which of the following is describes the most likely outcome(s) of this mutation: termination of translation within the coding sequence of the second exon termination of transcription within the coding sequence of the second intron termination of transcription before the coding sequence of the second exon termination...

  • Below is the DNA sequence of a protein-encoding Eukaryotic gene: 5’TAAACGCGATGGACCGACCATACAGTATCGACGCTCCAGGATGGTAAAATAAATGCCT3’ Based on this information, predict...

    Below is the DNA sequence of a protein-encoding Eukaryotic gene: 5’TAAACGCGATGGACCGACCATACAGTATCGACGCTCCAGGATGGTAAAATAAATGCCT3’ Based on this information, predict the mature mRNA sequence and the corresponding peptide sequence of this gene after transcription, RNA processing, and translation. Try to recognize and label the sequence features on the primary transcript you learned from the class that are important for Eukaryotic mRNA Processing (e.g. intron sites, poly-A adding site). Please also briefly describe the key steps taking place during RNA processing. For each step of...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT