HomeworkLib
Search
Solutions
Q&A
Blog
Scan Question
+ Post
Ask a Question
Post a Question (with Answer)
Post a Blog
Get Coins
Log In
Sign Up
Home
/
Topics
/
Biology
/
Biology Questions
Biology Questions
Which of the following statements is true for DNA only? ( it can be more than...
mention 3 functions of paleontology and define how applied to geologic record and whats the function...
A study is being done to test the effects of habitat space on the size of...
Directions: Provide short answers of 100-150 words each for the following questions/statements. Do not exceed 200...
) How would you dilute 2.0 ml of concentrated cells to get a dilution factor of...
Jean-Baptiste Lamarck who was alive prior to Darwin (pre-Darwin evolutionary theory) and has left a legacy...
You are an entomologist studying the population genetics of aphids. Aphids are insects that “suck” the...
Insulin is a protein that is used by the body to regulate both carbohydrate and fat...
Be able to describe the structure of the TCR and associated CD3 complex, how it is...
The Pinzgauer breed of cattle has a distinctive white strip down the back, the result of...
Identify examples of evidence that a population has a size that is density dependent. 1- The...
n a reproduction of an experiment famously performed by Louis Pasteur, you cultured yeast in the...
PCR is an in vitro technique that can be said to mimic a biological function in...
As you become more familiar with the literature in behavioral ecology, you will encounter the terms...
At which phase(s) is it preferable to obtain chromosomes to prepare a karyotype? Question 1 options:...
Answer the following genetics problems. Show your work! A parent plant with alleles for colors of...
When a pathogen enters a host cell, there are ________ fates for the pathogen
Draw a typical prokaryotic gene with its promoter and terminator. Draw the primary transcript Label (using...
Which of these statements about the evolutionary tree of animals is incorrect? a) All animals are...
Cell Organelles and their Functions This unit we are learning about cells and the organelles contained...
Mrs. Smith came in through the front door of her house with an armful of groceries....
An exponentially growing culture has a specific growth rate constant, K = 2.4 day-1. What is...
1. The patient with rifampin-resistant tuberculosis, what evidence indicated that the resistant strain evolved within the...
Estimate how many collisions a water molecule undergoes at room temperature in 1 μs. Envision a...
What term describes the simultaneous occurrence of anabolism and catabolism in glucose metabolism? Please name one...
1. What is the “fear imprint” stage of the development of a young animal (including humans)?...
ENDOCRINE System: Body System Outline Summary of system functions: System Interactions System List List of Interactions...
A 57-year-old man from Central America with HIV presented to a local clinic in Panama. He...
What did Paul Ehrlich achieve with his discovery of 606 that was new to the field...
Pseudomonas aeruginosa is a clinically significant opportunistic pathogen and the main cause of morbidity and mortality...
The government of Mahandar wants to expand biodiversity conservation efforts on the island. The government has...
• Nitrogenase, the enzyme responsible of nitrogen fixation (conversion of the atmospheric gas N2 into ammonia...
You want to make a live virus vaccine against the COVID-19 virus by using zoonotic coronaviruses,...
Can you discuss the troubled and complex relationship between the field of psychiatry and the study...
describe two ways by which regulatory network can be constructed in cells?
Setup the reaction conditions for EcoR1 enzyme (to digest 1 ug of DNA). Make sure to...
A dihybrid cross is performed in Drosophila - one parent is heterozygous for both genes (B/b...
The choices are mitosis, meiosis, both or neither. - two identical daughter cells are formed ...
1. Which is longer in the toad, the fore limb or the hind limb? Why is...
Why might the behavioral tendencies to seek out “autonomy” increase reproductive success? Question options: a) autonomy...
In rainbow trout, you are studying scale color and patterning. You have identified two genes: R...
Consider the reaction that causes RNA to hydrolyze at high PH. Why is RNA more sensitive...
Nucleic Acids List the two types of nucleic acid polymers. Describe how information flows from DNA...
The ______ is the collection of chemical markers that genes accumulate which affects how they are...
Explain and compare/contrast the use of the following two methods of investigating biological driven export from...
Can you determine protein-protein interation from qPCR? If so, please explain how.
What is the relationship between Natural Selection and antibiotic resistance? How has Horizontal Gene Transfer (HGT)...
discuss Infection caused by a specific bacteria (gonococcus) Neisseria gonorrhoeae
how does strong selection occuring in a population impact the molecular clock
What of the following aids the flow of lymph? A) hydrostatic pressure of interstitial fluid B)...
1. Upon virus break-up in a host cell, in order for the virus to complete its...
What, ultimately, killed the people that ingested the cyanide? Why did their autopsy indicate that they...
Give three approaches that could be used to confirm that a putative peptides/proteins is exist.
What are two differences between the core promoter and the regulatory promoter for RNA pol II...
Check each of the following adaptations that are likely to aid an organism in coping with...
Hepatits C What is that causative agent of Hep C. Describe the microbe involved. If known,...
1. Which of the following historical developments contributed to the current Human Microbiome project? A. Advances...
A tetrapeptide with the sequence, (lysine-isoleucine-asparatate-seriene), has been isolated from a protein hydrolysate mixture. A solution of...
what forces stabilize secondary, tertiary, and possible quaternary structure of Fructose 1,6 bisphosphatase? where is the...
An unknown virus has 23% cytosine residues. Can you work out the chemical composition (A, T,...
Will macrophages give positive results to localize alpha tubulin in the esophagus and trachea? Why or...
What types of food packaging could be used to block the penetration of the food by...
what is a introduction and background based on veterans that have been diagonsed with traumatic brain...
Name three things that can happen to light energy (solar radiation) after striking a leaf.
Explain the sequence of physiological events leading to fever.
why is it important to observe Effect 30 uM of Nocodazole has on hyphal Fungal Tip...
choose the correct answer of tge following questions and explain why the other choises are incorrect...
What would happen if the Cas9 part of CRISPR-Cas9 wasn't functional? Would CRISPR be as effective?
A variable is a factor that can be changed either by the researcher or by the...
What condition refers to abnormally high levels of blood glucose? hyperglycemia hypoglycemia hypertension hyperlipidemia
How would you (literally) make a 1.5L stock of 10x Western Transfer Buffer, which contains 0.11...
How would you produce a 10^-1 dilution of 2.0ml of concentrated cells using the full 2...
Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI DNA sequence B: ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC CGCCAGGCGGAACGCATGAGCCAGATT
The following questions are from the published research article: Segre, L. et al. (2014). Depression and...
Will our artificial enzyme,CelB-GFP, dissociate into subunits during SDS-PAGE? Why or why not?
what is a key DIFFERENCE between the colonial and aggregation hypotheses for multicellularity
Scientists from the CDC were tracking a series of sick individuals in more than a dozen...
Model organisms are often used to study biological questions including those related to regeneration. Muse upon...
Calculate the free energy change for translocating a proton out of the mitochondrial matrix, where pHmatrix...
Match the term to the correct description. Choices may only be used once. Group of...
‹
1
2
...
107
108
109
110
111
112
113
...
124
125
›
ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
Share Your Knowledge
Post an Article
+5 Coins
Post an Answer
+5 Coins
Post a Question with Answer
+5 Coins
Active Questions
Where is the error in this code sequence? String s1 = "Hello"; String s2 = "ello";...
asked 11 months ago
Financial data for Joel de Paris, Inc., for last year follow: Joel de Paris, Inc. Balance...
asked 11 months ago
Consider this reaction: Al2(SO4)3 (aq)+ BaCl3 (aq) Al2Cl6 (aq)- + 3BaSO4(s) . What is the...
asked 11 months ago
Suppose that Savneet is considering increasing her recent random sample from 20 car rentals to 40...
asked 11 months ago
Trucks arrive at an unloading terminal at an average rate of 120 per hour. Trucks arrive...
asked 11 months ago
Why are methanol and ethanol completely soluble in water while octanol is not very little soluble....
asked 11 months ago
A facilities manager at a university reads in a research report that the mean amount of...
asked 11 months ago
When the CuSO4 is rehydrated by adding water to the anhydrous compound, is this an endothermic...
asked 11 months ago
A ray of sunlight is passing from diamond into crown glass; the angle of incidence is...
asked 11 months ago
A block of mass 0.249 kg is placed on top of a light, vertical spring of...
asked 11 months ago
how do the kidneys compensate in the presences of acidosis a) trigger hyperventilate b) reserve acid...
asked 11 months ago
Question 501 pts The rental rate of capital to the firm increases. Which of the following...
asked 11 months ago
ADVERTISEMENT