Question

8. Design appropriate PCR primers for the human DDX3X gene. Give their sequences below and explain how you designed them (20

Forward Primer Reverse Primer

CDS /note=upstream in-Itu YUP LUUUIT 856..2844 /gene=DDX3X /gene synonym=DBX; DDX14; DDX3; HLP2 /EC_number=3.6.4.13 /no

1 cttt.cccctu act.ccgct.cc cctctttt.cc ctccctctcs u t ca tatatatat 61 cctcctcttc ccctcccctc ccccatccag agcactctat attcaageca.

2101 nacegang teguttag90 ggascarca cecaaacgat cocttctact tgacetecto 2161 concag geengate actacctta atatttatag agacca 99gcogat

3661 aaaguttaaa gatstgataa cttgaaatag gtttttagga gaattcatct acttagactt 3721 tttaaatgcc taccateaat gaaattgaaa tggtagaatg actga

0 0
Add a comment Improve this question Transcribed image text
Answer #1

We are asked to design PCR primers to amplify the human DDX3X gene.

From the cDNA sequence information given, the coding sequence starts at 856 nucleotides starting with ATG which is the start codon and ends at 2844 nucleotides with the stop codon TGA.

We need to design a forward primer starting from nucleotide 856 and a reverse primer ending at 2844 nucleotide.

In order to design the primers, we need to calculate the Tm or the melting tempaerature of each primer so that the Tm of both the primers are the same or are within 2\degreeC to 5 \degree C. This is to facilitate annealing of both the primers to the template during the annealing step. If the Tm values of the primers are further apart then one of them might not anneal to the template and we might not get the desired product. For best results, we should see to that primers with Tm values in the range of 50\degreeC to 60\degreeC.

The basic formula to calculate Tm of primers is : Tm = (2 * (A + T) + 4 * (C + G)), where A+T and C+G refer to the total number Adenine -Thymine and Guanine-cytosine bases respectively. This works for most primers of 14 nucleotides in length. For longer primers, the formula to be used is:

Tm = 81.5 + 0.41(%GC) - 675/N

where N is the total number of nucleotides.

Now, let us design the primers by using the region from nucleotide number 856 and 2844 for forward and reverse primers respectively.

Forward primer: 5'- ATGAGTCATGTGGCAGTGGA -3'

For the reverse primer, we need to write out the sequence in the reverse orientation. This is because the sequence made available to us is the 5'>3' sequence. During PCR, the forward primer would anneal to the 3'>5' strand whereas the reverse primer would anneal to the 5'>3' strand. Therefore the sequence of the forward primer would be the same as the 5'>3' strand whereas that of the reverse primer would be the same as the 3'>5' strand :

For the given sequence that ends with the stop codon, 5'- GACTGGTGGGGTAACTGA -3', the reverse complement of this sequence would be the reverse primer.

Reverse primer: 5'- TCAGTTACCCCACCAGTC -3'

Now, let us calculate the Tm of the primers:

Forward primer:
Number of nucleotides = 20
A + T = 10; G+T = 10
% GC = 10 / 20 * 100 = 0.5 * 100 = 50%

Tm = 81.5 + 0.41 ( 50 ) - 675 / 20 = 81.5 + 20.5 - 33.75 = 102 - 33.75 = 68.25 \degree C.

Reverse primer:

Number of nucleotides = 18
A + T = 8; G+C = 10
% GC = 10 / 18 * 100 = 0.555 * 100 = 55.5%

Tm = 81.5 + 0.41 ( 55.5 ) - 675 / 18 = 81.5 + 22.8 - 37.5 = 104.3 - 37.5 = 66.8 \degree C.


Add a comment
Know the answer?
Add Answer to:
8. Design appropriate PCR primers for the human DDX3X gene. Give their sequences below and explain...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • To do the PCR, we used 2 universal primers that roughly match sequences near the 5’...

    To do the PCR, we used 2 universal primers that roughly match sequences near the 5’ and 3’ ends of the 16S rRNA gene. The forward primer binds near the 5’ end to the complementary strand of the sequences shown below. The sequence of the forward primer is: Agagtttgatcctggctcag The reverse primer binds near the 3’ end to the sequences shown below. The sequence of the reverse primer is: ACGGCTACCTTGTTACGACTTG To find the primer in the sequence below, you must...

  • 1. Create the primers to amplify the gene of interest. 1. Below is almost the full...

    1. Create the primers to amplify the gene of interest. 1. Below is almost the full sequence of the coding strand of the F9 gene (exon 2-exon4) that you found in the online database (NCBI, Genomic sequence F9 gene). Some of the sequence is missing, but you know how many nucleotides are skipped. Design forward and reverse primers 18nt each for PCR that will isolate EXACTLY the sequence that is in bold typeface. Exon 2 = 164 nt Intron 2...

  • If you were asked to design PCR primers to amplify this gene, provide in the space...

    If you were asked to design PCR primers to amplify this gene, provide in the space below the sequences (5’ à 3’) of both the forward and reverse (sense and antisense) primers required to amplify the gene. Design your primers to be exactly 15 bases in length each. Design them so that the forward primer extreme 5’ end matches up with the extreme end of the start codon, and the reverse primer extreme 5’ end matches up with the extreme...

  • CHAPTER 14: Identify the primer sequences that could be used in this PCR reaction shown below...

    CHAPTER 14: Identify the primer sequences that could be used in this PCR reaction shown below to amplify the target region highlighter in pink (which could be an important gene such as insulin that you want to make many copies of). At this point, the double-stranded DNA has been heated so that the strands are now in a single-strand formation. Be sure to pay attention to the DNA sequence and the 5' 3'ends of the primers. 5' GG CCA A...

  • 8. PCR is used to. A Diagnose genetic disease 8 Solve cnmes C Sudy gene unction...

    8. PCR is used to. A Diagnose genetic disease 8 Solve cnmes C Sudy gene unction D. All of th C ONA as a template to form RINA D All of the above 7. PCR technique does not need A. Tag polymerase B Restriion encymes C Olgoucletide prmers C. A fragment of skin D. All of the above 9 PCR can be used in A Cloning B.Sequening C.Medical dagnosis&foric mine 0.PCR can make mullple copies ot A. DNA B RNA...

  • QUESTION 1: You are inserting a gene into an MCS found within the LacZ gene. Using...

    QUESTION 1: You are inserting a gene into an MCS found within the LacZ gene. Using blue/white colony selection, why could you assume that white colonies have modified plasmids? a. A blue colony means the LacZ reading-frame was disrupted b. A blue colony means your gene has mutations c. A white colony means the LacZ reading-frame is intact d. A white colony means the LacZ reading-frame was disrupted    QUESTION 2: You are performing a PCR using primers with a sequence perfectly...

  • Below is a set of experiments for cloning the human growth hormone (HGH) gene and then...

    Below is a set of experiments for cloning the human growth hormone (HGH) gene and then expressing the HGH protein in E. coli starting from human pituitary glands and a tube of plasmid vector DNA. The plasmid expression vector contains the arabinose inducible expression system. Specify the correct order for carrying out these experiments, using the letter codes in front of each procedure. Use all of the steps in your answer, except for one step that should NOT be included....

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • For the questions below, be sure to write all oligonucleotide sequences 5'+3'. You are researching a...

    For the questions below, be sure to write all oligonucleotide sequences 5'+3'. You are researching a rare human leukemia that is caused by a mutation in a small protein called Cdr (for Cell Division Regulator). It has been found that patients with this rare leukemia contain a mutation in the 5' untranslated region of cdr. The mutation is a GỮA transition at nucleotide 7 of the transcript. Human Chromosome G7A 5' (sense strand) sequence included in cdr transcript gtactgcctattatgcagtettataagaaactaggtgccatggccttgacaggttctattagacactgtcggttgggcagacataatgagtctctagttgatgggagacgaccacgctgtcagtaagtactttttgcettcttatgccgtaccgac DNA...

  • The macromolecular complex that associates with each intron and splices it is called a(n). splicer acrosome...

    The macromolecular complex that associates with each intron and splices it is called a(n). splicer acrosome splice engine spliceosome splicing body Transcription in prokaryotes: 1. Requires consensus nucleotide sequences at position -35 and -10 in the promoter region of gene sequence. 2. Requires different sigma factors depending on the environmental stimulus. 3. Can produce a cDNA. All are correct. 3 1 Both 1 and 2 are correct. Which of the following statements about transcription factor TFIIH are correct: Two of...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT