
Need help with biochemistry please 3. RNA splicing. Eukaryotic mRNAs are frequently spliced before they are...
5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon 3. The 5ʹ splice site at the boundary between exon 2 and intron 2 has been eliminated by a small deletion in the gene. Describe how the pre-mRNA encoded by this mutant gene would be spliced. Indicate which introns and exons would be found in the mRNA after splicing occurs
The SR protein SRn2
can auto-regulate its own level using a type of alternative
splicing known as "unproductive splicing." The SRn2 gene
(shown above) can be alternatively spliced to give two distinct
mRNAs: mRNA (A) is stable and actively translated, while mRNA (B)
includes the alternative exon 2a and is targeted by nonsense
mediated decay (NMD). It is observed that when levels of SRn2
protein rise, the levels of its productively spliced mRNA
fall (and vice versa).
1) Propose a...
3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the transcript: AUU UCU VUA GCA AGA GCU... Al The corresponding amino acids in the normal CFTR protein are: (Use either the one-or three-letter amino acid codes A naint mutation changes the last nucleotide from U to C. At the DNA level, this is a transition transversion c) At the protein level, this is a (silent / missense / nonsense/frameshift ) mutation. D) Instead of...
1.The change of the base sequence of eukaryotic RNAs after they have been transcribed is known as -RNA editing -Base modification -Processing -Splicing 2. true or false.. during elongation of transcription, RNA polymerase is primarily in a closed complex. 3. In sickle cell anemia, the β-globin gene has a valine at position 6 instead of the normal glutamic acid. The remaining protein sequence is unchanged. This is an example of which of the following types of mutations? - Silent mutation...
1) The universal genetic code is used to translate aminoacids from a. codons in the DNA b. codons in the mRNA c. codons in tRNA d. codons in rRNA 2) In RNA, introns are: a. nucleotide sections that do not code for proteins and are not removed before translation b. nucleotide sections that code for proteins and must be removed before transcription c. nucleotide sections that do not code for proteins and must be removed before translation d. nucleotide sections...
What is the function of the 3' poly-A sequence in eukaryotic mRNA? Select one: O a. Intron splicing signal. O b. Initial attachment site for ribosomes. O c. Translation termination. O d. Protection from cytosolic enzymes. What is the function of the 5' cap in eukaryotic mRNA? Select one: O a. Polyadenylation of the 5' end of the mRNA. b. Intron splicing signal. O c. It must be on the mRNA in order for the mature mRNA to be exported...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
please help with this genetics question! i really need
help
1. Diagram a eukaryotic gene containing three exons and two introns. Your diagram should show DNA and the mature mRNA molecules. Show the following (if it exists in the DNA indicate so, if it exists in the mature mRNA, indicate so): a. AG and GU dinucleotides corresponding to intron-exon junctions b. +1 TSS C. 5' and 3' UTRS d. the start codon sequence e. the stop codon sequence f. the...
1. Which of the following statements about the flow of genetic information is true? a. Proteins encode information that is used to produce other proteins of the same amino acid sequence. b. RNA encodes information that is translated into DNA, and DNA encodes information that is translated into proteins. c. Proteins encode information that can be translated into RNA, and RNA encodes information that can be transcribed into DNA. d. DNA encodes information that is translated into RNA, and RNA...
Follow the instructions below to answer questions about
Replication, Transcription & Translation.
3’- T A C A
C C G G
T C A G
G T G A T C
-5’
A. Imagine that the sequence shown represents one strand of a
gene sequence. What would be the sequence of the complementary
strand of DNA? Write out your answer, indicating correct
polarity (5' and 3' ends) on your new strand. (1.5
points)
B. Now imagine that the new strand...